.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i23

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Oxidoreductase (Gfo/Idh/MocA family) from Enterococcus faecalis. Northeast Structural Genomics Consortium target id EfR167. To be Published
    Site NESGC
    PDB Id 3i23 Target Id EfR167
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS31781,3.30.360.10, PF02894, 3.40.50.720, PF01408 Molecular Weight 39340.51 Da.
    Residues 349 Isoelectric Point 5.21
    Sequence mtvkmgfigfgksanryhlpyvmiretlevktifdlhvnekaaapfkekgvnftadlnelltdpeieli tictpahthydlakqailagksvivekpfcdtlehaeelfalgqekgvvvmpyqnrrfdgdylamkqvv eqgflgeinevethidyyrpgsiteqgpkengsfyglgihlmdrmialfgrpdqvtydirnnevseavd nyfdvdlhygsklkvkvktnhsvaspyprfivhgsngsfikygedqqendlkagimpdapgfgedspmy ygevtyrngngdwikkqiktpvgdygryydavyetlkngapqlvtkeqaltnieileagflnpspsvyhlken
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.209
    Matthews' coefficent 2.75 Rfactor 0.157
    Waters 133 Solvent Content 55.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3i23
    1. Structural model for phenylalkylamine binding to L-type calcium channels
    RCK Cheng, DB Tikhonov, BS Zhorov - Journal of Biological Chemistry, 2009 - ASBMB
     
    2. TARGETING NAD BIOSYNTHESIS IN BACTERIAL PATHOGENS
    A Mackerell, H Zhang, A Osterman - US Patent App. 13/ , 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch