.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i3u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of lp_1913 protein from lactobacillus plantarum, northeast structural genomics Consortium target lpr140a. To be Published
    Site NESGC
    PDB Id 3i3u Target Id LpR140A
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS31792,3.40.250.10, PF00581 Molecular Weight 12169.41 Da.
    Residues 112 Isoelectric Point 6.06
    Sequence mndkkiellttylslyidhhtvladmqnatgkyvvldvrnapaqvkkdqikgaiampakdlatrigeld paktyvvydwtggttlgktallvllsagfeayelagalegwkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.291
    Matthews' coefficent 1.86 Rfactor 0.264
    Waters 50 Solvent Content 33.89

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch