The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target MbR246. To be Published
    Site NESGC
    PDB Id 3i7j Target Id MbR246
    Molecular Characteristics
    Source Mycobacterium bovis
    Alias Ids TPS31803,3.40.710.10, PF00144 Molecular Weight 28383.47 Da.
    Residues 272 Isoelectric Point 5.16
    Sequence mtalevlggwpvpaaaaavigpagvlathgdtarvfalasvtkplvaraaqvaveegvvnldtpagppg stvrhllahtsglamhsdqalarpgtrrmysnygftvlaesvqresgiefgrylteavceplgmvttrl dggpaaagfgatstvadlavfagdllrpstvsaqmhadattvqfpgldgvlpgygvqrpndwglgfeir nsksphwtgecnstrtfghfgqsggfiwvdpkadlalvvltardfgdwaldlwpaisdavlaeyt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.233
    Matthews' coefficent 3.08 Rfactor 0.185
    Waters 374 Solvent Content 60.01

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch