.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ign

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the GGDEF domain from Marinobacter aquaeolei diguanylate cyclase complexed with c-di-GMP. To be Published
    Site NESGC
    PDB Id 3ign Target Id MqR89A
    Molecular Characteristics
    Source Marinobacter aquaeolei
    Alias Ids TPS31801,3.30.70.270, PF00990 Molecular Weight 18956.15 Da.
    Residues 168 Isoelectric Point 5.04
    Sequence eqlaklsmtdrltgllnrgtwenlvdaeyerfrrygqatslvmfdidhfkpvndtyghlagdevirhta dvtrnnirqsdsagryggeefgiilpetdaesarvicerireaiekstvstsagdiqytvsmgiaqlte tpenymqwmqkadealykakesgrnkvvvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.83 Rfree 0.2405
    Matthews' coefficent 2.55 Rfactor 0.1950
    Waters 168 Solvent Content 51.72

    Ligand Information
    Ligands C2E (9,9'-[(2R,3R,3AS,5S,7AR,9R,10R,10AS,12S,14AR)-3,5,10,) x 2
    Metals

    Jmol

     
    Google Scholar output for 3ign
    1. Diversity of structure and function of response regulator output domains
    MY Galperin - Current opinion in microbiology, 2010 - Elsevier
     
    2. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    3. Discovery notes Presence of a classical RRM-fold palm domain in Thg1-type 3'-5'nucleic acid polymerases and the origin of the GGDEF and CRISPR
    V Anantharaman, LM Iyer, L Aravind - 2010 - biomedcentral.com
     
    4. The structure and inhibition of a GGDEF diguanylate cyclase complexed with (c-di-GMP) 2 at the active site
    CY Yang, KH Chin, MLC Chuah, ZX Liang - Section D: Biological , 2011 - scripts.iucr.org
     
    5. Structural adaptation of extreme halophilic proteins through decrease of conserved hydrophobic contact surface
    A Siglioccolo, A Paiardini, M Piscitelli - BMC Structural , 2011 - biomedcentral.com
     
    6. Crystal structure of a catalytically active GG (D/E) EF diguanylate cyclase domain from Marinobacter aquaeolei with bound c-di-GMP product
    SM Vorobiev, H Neely, B Yu, J Seetharaman - Journal of structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch