.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ihk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SmR83. To be published
    Site NESGC
    PDB Id 3ihk Target Id SmR83
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS31765,3.40.50.10240, PF04265, PF04263, 2.60.120.320 Molecular Weight 23712.84 Da.
    Residues 210 Isoelectric Point 5.02
    Sequence mtkvalfsggdltyftrdfdyfvgidkgssfllknqlpldlaigdfdsvsaeefkqikakakklvmapa ekndtdtelalktifdcfgrveiivfgafggridhmlsniflpsdpdlapfmrcfklrdeqnlveffpa gqhqieqatdmvyisfmaangahlsiqdakyelteenyfqkkiyssnefkdkpicfsvasgyvvviqtk drt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 3.00 Rfree 0.243
    Matthews' coefficent 2.57 Rfactor 0.203
    Waters 1 Solvent Content 52.21

    Ligand Information
    Ligands TPP (THIAMINE) x 3;PO4 (PHOSPHATE) x 16
    Metals MG (MAGNESIUM) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch