The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target VfR136. To be Published
    Site NESGC
    PDB Id 3jvn Target Id VfR136
    Molecular Characteristics
    Source Vibrio fischeri
    Alias Ids TPS31771,3.40.630.30, PF00583 Molecular Weight 18742.67 Da.
    Residues 158 Isoelectric Point 4.99
    Sequence mapvirrakeidlyclnslmyklhdehhqqcpdlfktaseieeeksiarylddpecmvyvaemddviig fitghfcelistvsklvmmatidelyiekeyrregvaeqlmmrieqelkdygvkeifvevwdfnkgale fynkqglnehihylrkplnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.61 Rfree 0.273
    Matthews' coefficent 2.20 Rfactor 0.233
    Waters 27 Solvent Content 44.08

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch