The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target CdR100D. To be Published
    Site NESGC
    PDB Id 3k1y Target Id CdR100D
    Related PDB Ids 3k20 
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS31789,PF02525, PF03358, Molecular Weight 18870.44 Da.
    Residues 181 Isoelectric Point 4.78
    Sequence mrtlavisaglstpsstrqiadsiseavtaavsargealsvstielselipdlmtamttrvhttkleei tsalsasdglvvatpvfkasytglfkmffdildtdaltgmptiiaatagsarhslvldyalrpllsymr avvvptgvfaatedfggpegaefnkriaraagelasliveesg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.50 Rfree 0.241
    Matthews' coefficent 2.53 Rfactor 0.229
    Waters 205 Solvent Content 51.38

    Ligand Information
    Ligands SO4 (SULFATE) x 16



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch