The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Lmo2511 protein from Listeria monocytogenes, northeast structural genomics consortium target LkR84A. To be Published
    Site NESGC
    PDB Id 3k2t Target Id LkR84A
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS31839,BIG_1093 Molecular Weight 6516.00 Da.
    Residues 57 Isoelectric Point 5.13
    Sequence eivrtkqfslkpmdseeavlqmnllghsfyvytdaetngtnivysrkdgkyglietn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.274
    Matthews' coefficent 2.40 Rfactor 0.244
    Waters 14 Solvent Content 48.72

    Ligand Information


    Google Scholar output for 3k2t
    1. Periodic rigidity of protein crystal structures
    P Clark, J Grant, S Monastra - Advances in Bio and , 2012 - ieeexplore.ieee.org

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch