.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k7x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Lin0763 protein from Listeria innocua. To be Published
    Site NESGC
    PDB Id 3k7x Target Id LkR23
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS31739,BIG_251, PF03663, 1.50.10.10 Molecular Weight 39910.11 Da.
    Residues 341 Isoelectric Point 4.85
    Sequence mkwseyanlaqqslekfyladtkeqflnnfyptenpeednkvfnywwlahlvevrldaylrtkkqadle vaektylhnknrnggtlihdfyddmlwnalaayrlykatgksiyledaqlvwqdlvdtgwndimgggfa wrrpqmyykntpvnapfiilscwlynelnetkylewamktyewqtkvlvredgfvedginrledgtidy ewkftynqgvyiganlelyritkeakyldtanktaaislkeltedgifkdegnggdeglfkgifyryft dlieetanktyrdfvlnscqilvenakldgyllmgmnwkekpsgkipysaelsgmialemaakle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.89 Rfree 0.1843
    Matthews' coefficent 2.25 Rfactor 0.1674
    Waters 451 Solvent Content 45.29

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3k7x
    1. The molecular characterization of a novel GH38 [alpha]-mannosidase from the crenarchaeon Sulfolobus solfataricus revealed its ability in de-mannosylating
    B Cobucci-Ponzano, F Conte, A Strazzulli, C Capasso - Biochimie, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch