The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target GtR2. To be Published
    Site NESGC
    PDB Id 3k94 Target Id GtR2
    Molecular Characteristics
    Source Geobacillus thermodenitrificans
    Alias Ids TPS31766,, PF04265, PF04263, Molecular Weight 24045.17 Da.
    Residues 215 Isoelectric Point 4.67
    Sequence miihivgggprellpdlrfydgedvcwvgvdrgtmtlleagfrpvrafgdfdslpaedvvklqqafpdl dvwpaekdktdmeialdwaveqtarcirlfgatggrldhlfgnvelllkyadrpieivdrqnvltvhlp gtytvmydarycyvsyipvsetvaeftltgfkypltnchisrgstlcisneliqssgtfsfsegilmmi rssdsscl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2417
    Matthews' coefficent 2.05 Rfactor 0.1769
    Waters 250 Solvent Content 39.95

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch