The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of the Rhodanese-like domain of the Alr3790 protein from Anabaena sp. To be Published
    Site NESGC
    PDB Id 3k9r Target Id NsR437C
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS31796,, PF00581 Molecular Weight 11529.21 Da.
    Residues 106 Isoelectric Point 4.84
    Sequence piepqsdahvlksrlewgepaftildvrdrstyndghimgamampiedlvdrasssleksrdiyvygag deqtsqavnllrsagfehvselkgglaawkaiggpte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.96 Rfree 0.229
    Matthews' coefficent Rfactor 0.203
    Waters 289 Solvent Content

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch