.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ka5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Ribosome-associated protein Y (PSrp-1) from Clostridium acetobutylicum. To be Published
    Site NESGC
    PDB Id 3ka5 Target Id CaR123A
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS31840,BIG_1093 Molecular Weight 6603.18 Da.
    Residues 57 Isoelectric Point 4.89
    Sequence eivktkrfaikpmseeeavlemellghnffvfqngdsnevnvvykrkdgnygliepe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.233
    Matthews' coefficent 2.25 Rfactor 0.205
    Waters 86 Solvent Content 45.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ka5
    1. Mycobacterium tuberculosis DosR Regulon Gene Rv0079 Encodes a Putative,'Dormancy Associated Translation Inhibitor (DATIN)'
    A Kumar, M Majid, R Kunisch, PS Rani, IA Qureshi - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch