.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kat

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target HR3486E. To be Published
    Site NESGC
    PDB Id 3kat Target Id HR3486E
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS31810,PF00619, 1.10.533.10 Molecular Weight 10052.06 Da.
    Residues 84 Isoelectric Point 7.10
    Sequence lhfvdqyreqliarvtsvevvldklhgqvlsqeqyervlaentrpsqmrklfslsqswdrkckdglyqa lkethphlimelwek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.10 Rfree 0.260
    Matthews' coefficent 2.61 Rfactor 0.202
    Waters Solvent Content 52.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kat
    1. Polypeptide Modulators of Caspase Recruitment Domain (CARD)-CARD-mediated Protein-Protein Interactions
    Y Palacios-Rodrguez, G Garca-Lanez - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch