The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target NsR141. To be Published
    Site NESGC
    PDB Id 3kb4 Target Id NsR141
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS31743,PF05019, BIG_276 Molecular Weight 24584.19 Da.
    Residues 217 Isoelectric Point 5.01
    Sequence mietitqsqetailesflelvkspygnfasigklshvlndpdtlqkvvavlsltpqgkqafedrpmlgk idleqlhqlpnytlgymyadhmirnqltpppvnenvnhpfmflaahlgethdiwhvvtgcdtdkpgevk leafytaqlipdrlflallaknllktamyevelceqildgltqgwmmgkrakplfgiewnklwetplee lqtslnivpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.41 Rfree 0.220
    Matthews' coefficent Rfactor 0.194
    Waters 127 Solvent Content

    Ligand Information
    Ligands GR0 (GERANYLGERANYL) x 4
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch