.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kbg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the 30S ribosomal protein S4e from Thermoplasma acidophilum. To be Published
    Site NESGC
    PDB Id 3kbg Target Id TaR28
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS31746,PF01479, PF00900, BIG_222, 3.10.290.10 Molecular Weight 26508.58 Da.
    Residues 237 Isoelectric Point 9.80
    Sequence miminktkrlmvsrqvkiprktyfwgptpnpgmhpkdqsvtllsiirdylklsdkereaarilanglvk vdgktvrekkfavgfmdvieingesyrvvyndqgalvlmketkerasmkllkvrskviapgnriqlgth dgrtfitddkskkvgdvwavsvpdmkiseiikmqpgnkayitagshvnqtgtiskieakegssanlvhf qegfstikdhvfmigsskfsfvlspeevip
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.2172
    Matthews' coefficent 2.15 Rfactor 0.1844
    Waters 193 Solvent Content 42.85

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kbg
    1. The human RPS4 paralogue on Yq11. 223 encodes a structurally conserved ribosomal protein and is preferentially expressed during spermatogenesis
    A Lopes, R Miguel, C Sargent, P Ellis - BMC molecular , 2010 - biomedcentral.com
     
    2. Cloning, Escherichia coli expression, purification, characterization, and enzyme assay of the ribosomal protein S4 from wheat seedlings ( Triticum vulgare
    M Yadaiah, P Nageswara Rao, B Sudhamalla - Protein expression and , 2012 - Elsevier
     
    3. Cysteine protease attribute of eukaryotic ribosomal protein S4
    B Sudhamalla, M Yadaiah, D Ramakrishna - et Biophysica Acta (BBA , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch