.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kkj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of P. syringae q888a4 Oxidoreductase at resolution 2.5A, Northeast Structural Genomics Consortium target PsR10. To be Published
    Site NESGC
    PDB Id 3kkj Target Id PsR10
    Molecular Characteristics
    Source Pseudomonas syringae
    Alias Ids TPS20384,PF01266, PF07992, 3.90.660.20, 3.50.50.60, 3.90.660.10, PF01593, 3.40.50.720, PF00890 Molecular Weight 35837.65 Da.
    Residues 328 Isoelectric Point 6.35
    Sequence mtvpiaiigtgiaglsaaqaltaaghqvhlfdksrgsggrmsskrsdagaldmgaqyftardrrfatav kqwqaqghvaewtpllynfhagrlspspdeqvrwvgkpgmsaitramrgdmpvsfscritevfrgeehw nlldaegqnhgpfshviiatpapqastllaaapklasvvagvkmdptwavalafetplqtpmqgcfvqd spldwlarnrskperddtldtwilhatsqwsrqnldasreqviehlhgafaelidctmpapvfslahrw lyarpagahewgalsdadlgiyvcgdwclsgrvegawlsgqeaarrllehlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.281
    Matthews' coefficent 3.23 Rfactor 0.227
    Waters 174 Solvent Content 61.91

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kkj
    1. Renalase, a new secretory enzyme responsible for selective degradation of catecholamines: Achievements and unsolved problems
    AE Medvedev, AV Veselovsky, VI Fedchenko - Biochemistry (Moscow), 2010 - Springer
     
    2. Synthesis of human renalase1 in Escherichia coli and its purification as a FAD-containing holoprotein
    V Pandini, F Ciriello, G Tedeschi, G Rossoni - Protein expression and , 2010 - Elsevier
     
    3. FAD-binding site and NAD (P) reactivity in human renalase, a new enzyme involved in blood pressure regulation
    M Milani, F Ciriello, S Baroni, V Pandini - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch