.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kkz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q5LES9_BACFN protein from Bacteroides fragilis. To be Published
    Site NESGC
    PDB Id 3kkz Target Id BfR250
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS31780,3.40.50.150, PF08242, PF08241, PF01209 Molecular Weight 29523.99 Da.
    Residues 259 Isoelectric Point 5.05
    Sequence msnenktihdfelnlicdffsnmerqgpgspevtlkalsfidnlteksliadigcgtggqtmvlaghvt gqvtgldflsgfidifnrnarqsglqnrvtgivgsmddlpfrneeldliwsegaiynigferglnewrk ylkkggylavsecswftderpaeindfwmdaypeidtipnqvakihkagylpvatfilpencwtdhyft pkvaaqkifltkyagnkiaeefsmlqsieeelyhkykeyygytffiakkirl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.68 Rfree 0.1860
    Matthews' coefficent 2.23 Rfactor 0.1419
    Waters 452 Solvent Content 44.83

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kkz
    1. Purification, crystallization and diffraction studies of the methyltransferases BT_2972 and BVU_3255 from antibiotic-resistant pathogens of the genus Bacteroides from
    V Kumar, N Mallika, J Sivaraman - Acta Crystallographica Section F: , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch