.
The Open Protein Structure Annotation Network
PDB Keyword
.

3koj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the SSB domain of Q5N255_SYNP6 protein from Synechococcus sp. To be Published
    Site NESGC
    PDB Id 3koj Target Id SnR59A
    Molecular Characteristics
    Source Synechococcus elongatus
    Alias Ids TPS31779,2.40.50.140, PF00436 Molecular Weight 10978.00 Da.
    Residues 98 Isoelectric Point 6.72
    Sequence mnscilqatvveapqlrytqdnqtpvaemvvqfpglsskdaparlkvvgwgavaqelqdrcrlndevvl egrlrinsllkpdgnrekqteltvtrvhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.2183
    Matthews' coefficent 2.97 Rfactor 0.2011
    Waters 182 Solvent Content 58.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3koj
    1. Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch
    N Kulshina, TE Edwards, AR Ferr-D'Amar - RNA, 2010 - rnajournal.cshlp.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch