.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kvp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SR378A. To be Published
    Site NESGC
    PDB Id 3kvp Target Id SR378A
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS31742, Molecular Weight 7502.69 Da.
    Residues 64 Isoelectric Point 4.27
    Sequence mgnqdtiietdngnsdyetpqptsfplehnhfgvmedgyikiyeynesrnevklkkeyaddele
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2372
    Matthews' coefficent 2.15 Rfactor 0.1938
    Waters 30 Solvent Content 42.68

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch