.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l6i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the uncharacterized lipoprotein yceb from e. coli at the resolution 2.0a. northeast structural genomics consortium target er542. To be Published
    Site NESGC
    PDB Id 3l6i Target Id ER542
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS24560,PF07273 Molecular Weight 18680.56 Da.
    Residues 168 Isoelectric Point 5.75
    Sequence mnqltqytiteqeinqslakhnnfskdiglpgvadahivltnltsqigreepnkvtltgdanldmnslf gsqkatmklklkalpvfdkekgaiflkemevvdatvqpekmqtvmqtllpylnqalrnyfnqqpayvlr edgsqgeamakklakgievkpgeivipftd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.2467
    Matthews' coefficent 2.51 Rfactor 0.2051
    Waters 140 Solvent Content 51.04

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch