.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ljv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target McR175M. To be Published
    Site NESGC
    PDB Id 3ljv Target Id McR175M
    Molecular Characteristics
    Source Methylococcus capsulatus str. bath
    Alias Ids TPS31800,PF08668, 1.10.3150.10 Molecular Weight 30011.17 Da.
    Residues 274 Isoelectric Point 5.00
    Sequence lcdslptasrtaaailnlaqredvtaealaqliqtdpaltgrilrfanapaqgtrrpvasvidaidlvg lpavrqfalslslidahregrceafdyaaywqkslaravalqsitaqastvapkeaftlglladvgrla latawpeeyseclrkadgealialererfatdhdeltrmlltdwgfpqvfidalqlsqqdeirdegrtg rfarqlalaqhiadhrlaeeprraalspllraearrcglgdedlarlladppadwldwtrtiglpgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.285
    Matthews' coefficent 2.08 Rfactor 0.237
    Waters 15 Solvent Content 40.85

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch