.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ljx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target McR175G. To be published 2009
    Site NESGC
    PDB Id 3ljx Target Id McR175G
    Molecular Characteristics
    Source Methylococcus capsulatus str. bath
    Alias Ids TPS31799,PF08668, 1.10.3150.10 Molecular Weight 30825.15 Da.
    Residues 279 Isoelectric Point 5.25
    Sequence drwnmhkpmlcdslptasrtaaailnlaqredvtaealaqliqtdpaltgrilrfanapaqgtrrpvas vidaidlvglpavrqfalslslidahregrceafdyaaywqkslaravalqsitaqastvapkeaftlg lladvgrlalatawpeeyseclrkadgealialererfatdhdeltrmlltdwgfpqvfidalqlsqqd eirdegrtgrfarqlalaqhiadhrlaeeprraalspllraearrcglgdedlarlladppadwldwtrtig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2186
    Matthews' coefficent 3.11 Rfactor 0.1887
    Waters 117 Solvent Content 60.47

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3ljx
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch