.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lm6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SR525. To be Published
    Site NESGC
    PDB Id 3lm6 Target Id SR525
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS31734,PF07451, 3.40.47.10 Molecular Weight 35997.80 Da.
    Residues 338 Isoelectric Point 5.36
    Sequence mkltgkqtwvfehpifvnsagtaagpkekdgplgslfdktydemhcnqkswemaerqlmedavnvalqk nnltkddidlllagdllnqnvtanyvarhlkipflcmfgacstsmetvavasalvdggfakralaatss hnataerqfrypteyggqkpdtatstvtgsgavvisqtpgdiqitsatvgkvsdlgitdpfdmgsamap aaadtikqhfkdlnrtaddydliltgdlsgvgspivkdilkedgypvgtkhddcglliytpdqqvfagg sgcacsavvtyshifkqlregklnrvfvvatgallsptmiqqketiptiahgvvferaggas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.241
    Matthews' coefficent 1.87 Rfactor 0.188
    Waters 115 Solvent Content 34.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lm6
    1. Role of a SpoVA Protein in Dipicolinic Acid Uptake into Developing Spores of Bacillus subtilis
    Y Li, A Davis, G Korza, P Zhang, Y Li - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch