.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lm8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SR677. To be Published
    Site NESGC
    PDB Id 3lm8 Target Id SR677
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS31767,3.40.50.10240, PF04265, PF04263, 2.60.120.320 Molecular Weight 24097.27 Da.
    Residues 214 Isoelectric Point 5.36
    Sequence mktinivaggpknlipdltgytdehtlwigvdkgtvtlldagiipveafgdfdsiteqerrriekaapa lhvyqaekdqtdldlaldwalekqpdiiqifgitggradhflgniqllykgvktnikirlidkqnhiqm fppgeydiekdenkryisfipfsediheltltgfkyplnnchitlgstlcisnelihsrgtfsfakgil imirstd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.253
    Matthews' coefficent 2.48 Rfactor 0.213
    Waters 67 Solvent Content 50.38

    Ligand Information
    Ligands VIB (3-(4-AMINO-2-METHYL-PYRIMIDIN-5-YLMETHYL)-5-(2-HYDROXY-) x 4;PO4 (PHOSPHATE) x 4
    Metals MG (MAGNESIUM) x 5

    Jmol

     
    Google Scholar output for 3lm8
    1. The prion protein binds thiamine
    R Perez_Pineiro, TC Bjorndahl, MV Berjanskii - FEBS , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch