.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lma

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the stage V sporulation protein AD (SpoVAD) from Bacillus licheniformis. To be Published
    Site NESGC
    PDB Id 3lma Target Id BiR6
    Molecular Characteristics
    Source Bacillus licheniformis
    Alias Ids TPS33440,3.40.47.10, PF07451 Molecular Weight 36189.09 Da.
    Residues 339 Isoelectric Point 5.53
    Sequence mkltgkqtwefenplfvnssgtavgpkekegplghlfdksydemhcnqknwemaerklmedavqsalsk qnlkkedidiflagdllnqnvtanyvarhlkipflclfgacstsmesiaissalidggfakralaatss hnataerqfrypteyggqkpgtatstvtgsgavvlsqqpggikitsatvgrvidlgitdsqdmgsamap aaadtikqhledlgrtpddydliltgdlsgvgspilkdllkeeginvgtkhndcglmiytpdqqvfagg sgcacsavvtfahifkeieagrlnrvlvvatgallsptiiqqkesipciahgvvferaergna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.99 Rfree 0.2109
    Matthews' coefficent 1.82 Rfactor 0.1681
    Waters 587 Solvent Content 32.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lma
    1. Role of a SpoVA Protein in Dipicolinic Acid Uptake into Developing Spores of Bacillus subtilis
    Y Li, A Davis, G Korza, P Zhang, Y Li - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch