.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lmf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target NmR72. To be Published
    Site NESGC
    PDB Id 3lmf Target Id NmR72
    Molecular Characteristics
    Source Nitrosospira multiformis
    Alias Ids TPS31829,BIG_720 Molecular Weight 12627.97 Da.
    Residues 113 Isoelectric Point 5.66
    Sequence mflytetdqnlqacidacnhcyrtclrmamnhcleaggkhveadhlrlmmncaeicqtslnfmlsgsrf spkvcgvcaeicdacaksceqldgmeecvqtcrqcaehcrkmaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.247
    Matthews' coefficent 3.32 Rfactor 0.209
    Waters 32 Solvent Content 62.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lmf
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch