.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lmm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target CdR35. To be Published
    Site NESGC
    PDB Id 3lmm Target Id CdR35
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS31737,PF04326 Molecular Weight 62827.25 Da.
    Residues 575 Isoelectric Point 5.05
    Sequence mtlslpnmegrreqliaqvesilasaadgrvqktketqsvdfkeeagrrngpqiepgkpenpeaadkla devacmantpgggalivgiedktgriigteldidwlrqgiftridvapdvvakrvlgqrvlaiyvaaaa epiedtsdrlrwrvgdscrpvdraewweyqraqsgfdpmaqvttatlgdarpaalalarkwdpafaelt deellrgigaldaegflsqagkllftsldrtaielsifdvhggqvlnrvvpepekscleqldyleqaln vvnknntvvegfvhkpvpeiprlavreamlnamihrdwnrsepidvrwieldstlivrspggfpaaits envlsnraarypaladlyralglvdkqgvgvdrmyqamialghrpptieeiagpfvettlvggrpvlpv lelvssivpearqddyriaivlyllfqrpfitidvvarglqsgkeaarnaleaarqttvagapliiahd gvwllgnacreilrkvepspfspvrylstdqaeltnaamlwlsevgdlatsdlmamcgvsrgtakacvd glvdeervvavgggrsrryrlve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.231
    Matthews' coefficent 4.31 Rfactor 0.183
    Waters 391 Solvent Content 71.48

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 6;CO (COBALT) x 4

    Jmol

     
    Google Scholar output for 3lmm
    1. CASP9 target classification
    LN Kinch, S Shi, H Cheng, Q Cong, J Pei - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch