.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lv4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the glycoside hydrolase, family 43 YxiA protein from Bacillus licheniformis. To be Published
    Site NESGC
    PDB Id 3lv4 Target Id BiR14
    Molecular Characteristics
    Source Bacillus licheniformis
    Alias Ids TPS33447,PF04616, 2.115.10.20, 2.120.10.10 Molecular Weight 52815.77 Da.
    Residues 473 Isoelectric Point 6.58
    Sequence mrkcfiqvlallfiiaacfapnqasaqtqkpvfsevtvhdpsiikangtyyvfgshlasakstdlmnwt qisssvhdgnplipnvyeelketfewaesdtlwapdvtqledgkfymyynacrgdsprsalglavaddi egpyknkgiflksgmdgisndgtpydatkhpnvvdphtffdqngklwmvygsysggifilemdkktgfp lpgqgygkkliggnhsriegayilyhpetqyyylymsfgglaadggynirvarsknpdgpyydaegham idvrgkegtlfddrsiepygvklmgnfsfnnkngyvspghnsafydeksgksylifhtrfpgrgeehev rvhqllmnkqgwpvvaphryageklekvkksdvigdyelvrhgkdisadikeskeirlnqngkitgava gtwkntghnkielkidgktydgvflrqwdaaserkvmtfsalsregdavwgsslkraef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.1903
    Matthews' coefficent 2.22 Rfactor 0.1464
    Waters 679 Solvent Content 44.68

    Ligand Information
    Ligands ACT (ACETATE) x 5
    Metals CA (CALCIUM) x 5

    Jmol

     
    Google Scholar output for 3lv4
    1. Substrate cleavage pattern, biophysical characterization and low-resolution structure of a novel hyperthermostable arabinanase from Thermotoga petrophila
    FM Squina, CR Santos, DA Ribeiro, J Cota - Biochemical and , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch