.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lz7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target IR63. To be Published
    Site NESGC
    PDB Id 3lz7 Target Id IR63
    Related PDB Ids 1sc0 2b6e 
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8939,PF03061, 3.10.129.10 Molecular Weight 15050.58 Da.
    Residues 138 Isoelectric Point 6.40
    Sequence mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsvalaetigsla gslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirteenklccvsrltlsvinl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.19 Rfree 0.2306
    Matthews' coefficent 2.10 Rfactor 0.1683
    Waters 239 Solvent Content 41.39

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 3lz7
    1. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch