The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the tetratricopeptide repeat domain protein Q2S6C5_SALRD from Salinibacter ruber. To be Published
    Site NESGC
    PDB Id 3ma5 Target Id SrR115C
    Related PDB Ids 2kcv 2kcl 
    Molecular Characteristics
    Source Salinibacter ruber dsm 13855
    Alias Ids TPS27301,,, 16084 Molecular Weight 10402.73 Da.
    Residues 91 Isoelectric Point 4.38
    Sequence edpedpftryalaqehlkhdnasralalfeelvetdpdyvgtyyhlgklyerldrtddaidtyaqgiev areegtqkdlselqdaklkaeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.2749
    Matthews' coefficent 2.51 Rfactor 0.2391
    Waters 8 Solvent Content 51.09

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch