.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mcu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the dipicolinate synthase chain B from Bacillus cereus. To be Published
    Site NESGC
    PDB Id 3mcu Target Id BcR215
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS54794,PF02441, 3.40.50.1950 Molecular Weight 21704.26 Da.
    Residues 199 Isoelectric Point 8.49
    Sequence mslkgkrigfgftgshctyeevmphlekliaegaevrpvvsytvqstntrfgegaewikkieeitgfka insivgaeplgpkipldcmviapltgnsmskfanamtdspvlmaakatlrngkpvvlavstndalglng vnlmrlmatkniyfvpfgqdapekkpnsmvarmelledtvlealqgkqlqpvvvekfrymn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.2413
    Matthews' coefficent 2.35 Rfactor 0.1964
    Waters 425 Solvent Content 47.74

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 7
    Metals

    Jmol

     
    Google Scholar output for 3mcu
    1. Binding Selectivity of RecA to a single stranded DNA, a computational approach
    C Carra, FA Cucinotta - Journal of molecular modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch