.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mej

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SR736. To be Published
    Site NESGC
    PDB Id 3mej Target Id SR736
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS55164,PF03816 Molecular Weight 35919.44 Da.
    Residues 322 Isoelectric Point 9.16
    Sequence meersqrrkkkrklkkwvkvvaglmaflviaagsvgayafvklnnaskeahvslargeqsvkrikefdp gkdsfsvlllgidarekngetvdqarsdanvlvtfnrkektakmlsiprdayvnipghgydkfthahay ggvdltvktveemldipvdyvvesnftafedvvnelngvkvtvksdkviqqikkdtkgkvvlqkgthtl dgeealayvrtrkadsdllrgqrqmevlsaiidkskslssipayddivdtmgqnlkmnlslkdaiglfp fitslksvesiqltgydyepagvyyfklnqqklqevkkelqndlgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.49 Rfree 0.2703
    Matthews' coefficent 2.40 Rfactor 0.2064
    Waters 27 Solvent Content 48.81

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3mej
    1. A widespread family of bacterial cell wall assembly proteins
    Y Kawai, J Marles-Wright, RM Cleverley, R Emmins - The EMBO , 2011 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch