.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mel

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target EfR150. To be Published
    Site NESGC
    PDB Id 3mel Target Id EfR150
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS54770,3.40.50.10240, PF04265, PF04263 Molecular Weight 24143.94 Da.
    Residues 214 Isoelectric Point 4.53
    Sequence msrvllvaggnpsdwptiepatydyfvgidrgclhlleadlplqlavgdfdslsreeyhfvqettetli qapaekddtdtqlalqealqrfpqaemtiigatggridhllanlwlpfeprfqgvlrqirlcdrqnsiq yyapgsyivpkepdkeylayccltpvenltlrrskylltnqdvpyptsyasnefieeaaafsfdagmia viqskdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.79 Rfree 0.2751
    Matthews' coefficent 2.92 Rfactor 0.2075
    Waters 6 Solvent Content 57.93

    Ligand Information
    Ligands TPP (THIAMINE) x 2;PO4 (PHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 11

    Jmol

     
    Google Scholar output for 3mel
    1. Microtubule-severing enzymes
    A Roll-Mecak, FJ McNally - Current opinion in cell biology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch