.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mgd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target CaR165. To be published
    Site NESGC
    PDB Id 3mgd Target Id CaR165
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS54760,3.40.630.30, PF00583 Molecular Weight 17187.84 Da.
    Residues 149 Isoelectric Point 7.77
    Sequence mmnyrkadmkdisllvsirkrqlidegiepnididkeltryfnnklannllvewiaeennqiiataaia fidfpptytnktgrkgyitnmyteptsrgngiatgmldrlvneakernihkiclvasklgrpvykkygf qdtdewlelnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2277
    Matthews' coefficent 2.17 Rfactor 0.1798
    Waters 293 Solvent Content 43.35

    Ligand Information
    Ligands ACO (ACETYL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch