.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mi6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the alpha-galactosidase from Lactobacillus brevis. To be Published
    Site NESGC
    PDB Id 3mi6 Target Id LbR11
    Molecular Characteristics
    Source Lactobacillus brevis
    Alias Ids TPS54788,PF02638, 3.20.20.70, PF01055, 3.20.20.80, PF02065 Molecular Weight 84435.43 Da.
    Residues 737 Isoelectric Point 5.14
    Sequence msihvneanltfhlqtdhtsyifqimkngeagqiyygprihvqptyqnlmsqewrdatpslneenpnfq patikaeyaslgkgdfrqpafqvtqangsriteltydhyqlltgkqrlanlpstfddtdddaqtlvvsf ndritglaldlnysifphqdvivksakftnpsseklvlnralssqldlpdanydliqfsgtwarerhly rhplrpgmqsisslrmasshqqnpfmmlarpqttdeqgavfgfnlvysgnfldaievdqystsriltgi npdefgwnlapqatfqtpeailsytsagmnqlsqqmasfyqqhlvnprfaheerpvlinnweatyfdfn eaklmtivnqakrlgiemfvlddgwfghrdddttslgdwfvdqrkfpdgiehfsqavhqqgmkfglwfe pemvsvdsdlyqqhpdwlihapkstptpgrhqfvldmarpevvdylfklmsqmiesanldyikwdmnry atemfssrltsdqqlelphryilgvyqlyarltqaypnvlfescasgggrfdlgmmyyapqawtsddtd aaerlliqfgtsygypqammgahvsavpndqmgritslktrgavaffgdlgyelditkmapteldqvkk qvafykcyrqlfqfgkfyridspfvedgnvtswqvvsddqkqaiaaryqllnhpnapytrfyfkglrpn qryqinddpstyygdelmnagyfvptiladgqeskdfytqlfvvtai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.2409
    Matthews' coefficent 2.20 Rfactor 0.1728
    Waters 499 Solvent Content 44.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mi6
    1. Crystal structure of [alpha]-galactosidase from Lactobacillus acidophilus NCFM: insight into tetramer formation and substrate binding
    F Fredslund, MA Hachem, RJ Larsen - Journal of molecular , 2011 - Elsevier
     
    2. _-Galactosidase/Sucrose Kinase (AgaSK), a Novel Bifunctional Enzyme from the Human Microbiome Coupling Galactosidase and Kinase Activities
    L Bruel, G Sulzenbacher, MC Tison, A Pujol - Journal of Biological , 2011 - ASBMB
     
    3. Functional metagenomics unveils a multifunctional glycosyl hydrolase from the family 43 catalysing the breakdown of plant polymers in the calf rumen
    M Ferrer, A Ghazi, A Beloqui, JM Vieites - PloS one, 2012 - dx.plos.org
     
    4. Raffinose family oligosaccharide utilisation by probiotic bacteria: insight into substrate recognition, molecular architecture and diversity of GH36 _-galactosidases
    MA Hachem, F Fredslund - Biocatalysis and , 2012 - informahealthcare.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch