.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mtt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of iSH2 Domain of Human Phosphoinositide 3-Kinase p85β Subunit Reveals Conformational Plasticity In the Interhelical Turn Region. To be Published
    Site NESGC
    PDB Id 3mtt Target Id HR5531C
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS55009, Molecular Weight 21510.20 Da.
    Residues 178 Isoelectric Point 6.30
    Sequence ivkedsveavgaqlkvyhqqyqdksreydqlyeeytrtsqelqmkrtaieafnetikifeeqgqtqekc skeylerfrregnekemqrillnserlksriaeihesrtkleqqlraqasdnreidkrmnslkpdlmql rkirdqylvwltqkgarqkkinewlgiknetedqyalmed
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.30 Rfree 0.2773
    Matthews' coefficent 6.62 Rfactor 0.2487
    Waters 14 Solvent Content 81.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mtt
    1. Structure of the iSH2 domain of human phosphatidylinositol 3-kinase p85 subunit reveals conformational plasticity in the interhelical turn region
    C Schauder, LC Ma, RM Krug - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch