The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target GR189. To be Published
    Site NESGC
    PDB Id 3ngw Target Id GR189
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS54758,3.90.550.10 Molecular Weight 22675.25 Da.
    Residues 200 Isoelectric Point 6.01
    Sequence mkvavlvggvgrrigmektevmlcgkkliewvlekyspfqtvfvcrdekqaeklssryeaefiwdlhkg vgsiagihaalrhfgscvvaaidmpfvkpevlehlykegekagcdalipkhdypepllayyaesaadel erailqgirkilvplerlnvvyypveklrkfdkelisffnintpddlkraeeicskmstegl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.31 Rfree 0.226
    Matthews' coefficent 2.72 Rfactor 0.183
    Waters 58 Solvent Content 54.70

    Ligand Information
    Metals CA (CALCIUM) x 2


    Google Scholar output for 3ngw
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch