.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nhv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target BhR228F. To be Published 2010
    Site NESGC
    PDB Id 3nhv Target Id BhR228F
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS54913,3.40.250.10, PF00581 Molecular Weight 15260.64 Da.
    Residues 136 Isoelectric Point 7.87
    Sequence anpneayrhymkklsyetdiadlsidikkgyegiivvdvrdaeaykechiptaisipgnkinedttkrl skekviitycwgpacngatkaaakfaqlgfrvkeliggieywrkengevegtlgakadlfwnmkkes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.50 Rfree 0.247
    Matthews' coefficent 3.14 Rfactor 0.195
    Waters 151 Solvent Content 60.89

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 3nhv
    1. Assessment of protein structure refinement in CASP9
    JL MacCallum, A Prez, MJ Schnieders - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch