.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nix

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of flavoprotein/dehydrogenase from Cytophaga hutchinsonii. To be Published
    Site NESGC
    PDB Id 3nix Target Id ChR43
    Molecular Characteristics
    Source Cytophaga hutchinsonii
    Alias Ids TPS54839,PF01494, PF01946, 3.50.50.60, PF04820, 3.40.50.720, PF07992, 3.30.9.10, PF03486 Molecular Weight 46286.33 Da.
    Residues 413 Isoelectric Point 6.00
    Sequence mqrekvdvlvigagpagtvaaslvnksgfkvkivekqkfprfvigesllprcmehldeagfldavkaqg fqqkfgakfvrgkeiadfnfsdqfsngwnwtwqvprgnfdktladeaarqgvdveyevgvtdikffgtd svttiedingnkreiearfiidasgygrviprmfgldkpsgfesrrtlfthikdvkrpvaaemegnrit avvhkpkvwiwvipfsngntsvgfvgepsyfdeytgtpeermramianeghiaerfkseeflfeprtie gyaisasklygdgfvltgnatefldpifssgatfamesgskggklavqflkgeevnwekdfvehmmqgi dtfrsfvtgwydgtlhavffaknpdpdhkrmicsvlagyvwdknnpfvkkhntilktlakviqmgeea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.60 Rfree 0.264
    Matthews' coefficent 2.67 Rfactor 0.237
    Waters 913 Solvent Content 53.88

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 8
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch