.
The Open Protein Structure Annotation Network
PDB Keyword
.

3njc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the yslB protein from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 3njc Target Id SR460
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS54444,3.30.1380.20, PF10702, BIG_84 Molecular Weight 17285.97 Da.
    Residues 148 Isoelectric Point 4.87
    Sequence mkskfeasidnlkeiemnayayelireivlpdmlgqdyssmmywagkhlarkfplesweefpaffeeag wgtltnvsakkqelefelegpiisnrlkhqkepcfqleagfiaeqiqlmndqiaesyeqvkkradkvvl tvkwdmkdpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.69 Rfree 0.2284
    Matthews' coefficent 2.35 Rfactor 0.1851
    Waters 186 Solvent Content 47.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3njc
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch