.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nng

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the F5/8 type C domain of Q5LFR2_BACFN protein from Bacteroides fragilis. To be Published
    Site NESGC
    PDB Id 3nng Target Id BfR258E
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS54915,PF00754, 2.60.120.260 Molecular Weight 17882.00 Da.
    Residues 159 Isoelectric Point 5.41
    Sequence svlytsytkpgnwsavdrsawsvscsnvyadddakygahlaidgeinttwftwgvanagecwwntvldr pvtltgfsvtkqsaygsgynlrsaeikvrkegetewvtyprvltfrnfkgadpqyaaieppipnvkefr incltpdnytgfaeinlyvkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.18 Rfree 0.224
    Matthews' coefficent 1.68 Rfactor 0.164
    Waters 109 Solvent Content 26.83

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3nng
    1. Improved crystallographic models through iterated local density-guided model deformation and reciprocal-space refinement
    TC Terwilliger, RJ Read, PD Adams - Section D: Biological , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch