.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nnq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the N-terminal domain of Moloney murine leukemia virus integrase, Northeast Structural Genomics Consortium Target OR3. To be Published
    Site NESGC
    PDB Id 3nnq Target Id OR3
    Molecular Characteristics
    Source Other
    Alias Ids TPS54134, Molecular Weight 12428.64 Da.
    Residues 106 Isoelectric Point 8.85
    Sequence miensspytsehfhytvtdikdltklgaiydktkkywvyqgkpvmpdqftfelldflhqlthlsfskmk allershspyymlnrdrtlknitetckacaqvnasks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.69 Rfree 0.2744
    Matthews' coefficent 2.58 Rfactor 0.2292
    Waters 36 Solvent Content 52.34

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3nnq
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch