.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nrn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESGC
    PDB Id 3nrn Target Id PfR223
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS54656,PF00890, 3.50.50.60, 3.40.50.720, PF01593 Molecular Weight 45805.64 Da.
    Residues 413 Isoelectric Point 5.95
    Sequence mravvvgaglggllagaflarngheiivleksamiggrftnlpykgfqlstgalhmiphgedgplahll rilgakveivnsnpkgkilwegkifhyreswkflsvkekakalkllaeirmnklpkeeipadewikeki genefllsvlesfagwadsvslsdltalelakeiraalrwggpglirggckavideleriimenkgkil trkevveinieekkvytrdneeysfdvaisnvgvretvkligrdyfdrdylkqvdsiepsegikfnlav pgeprigntivftpglmingfnepsaldkslaregytlimahmalkngnvkkaiekgweelleifpege pllaqvyrdgnpvnrtraglhiewplnevlvvgdgyrppggievdgialgvmkaleklnlgsfsewyl
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch