.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nwz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target BhR199. To be published
    Site NESGC
    PDB Id 3nwz Target Id BhR199
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS54810,PF03061, 3.10.129.10 Molecular Weight 18695.38 Da.
    Residues 168 Isoelectric Point 6.31
    Sequence mdkrlqqdrivdkmerflstaneeekdvlssivdgllakqerryatylasltqiesqeredgrfevrlp igplvnnplnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkpgmgtylravasivhqgkq rivvegkvytdqgetvamgtgsffvlrsrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.57 Rfree 0.2639
    Matthews' coefficent 2.00 Rfactor 0.2309
    Waters 16 Solvent Content 38.42

    Ligand Information
    Ligands SO4 (SULFATE) x 2;COA (COENZYME) x 1
    Metals

    Jmol

     
    Google Scholar output for 3nwz
    1. Assessment of template based protein structure predictions in CASP9
    V Mariani, F Kiefer, T Schmidt, J Haas - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    3. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch