.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nzq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Biosynthetic arginine decarboxylase ADC (SpeA) from Escherichia coli, Northeast Structural Genomics Consortium Target ER600. To be Published
    Site NESGC
    PDB Id 3nzq Target Id ER600
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS54649,3.20.20.10, PF02784, 2.40.37.10, BIG_694, PF00278 Molecular Weight 73894.62 Da.
    Residues 658 Isoelectric Point 4.83
    Sequence msddmsmglpssagehgvlrsmqevamssqeaskmlrtyniawwgnnyydvnelghisvcpdpdvpear vdlaqlvktreaqgqrlpalfcfpqilqhrlrsinaafkraresygyngdyflvypikvnqhrrviesl ihsgeplgleagskaelmavlahagmtrsvivcngykdreyirlaligekmghkvylviekmseiaivl deaerlnvvprlgvrarlasqgsgkwqssggekskfglaatqvlqlvetlreagrldslqllhfhlgsq manirdiatgvresarfyvelhklgvniqcfdvggglgvdyegtrsqsdcsvnyglneyanniiwaigd aceenglphptvitesgravtahhtvlvsniigverneytvptapaedapralqsmwetwqemhepgtr rslrewlhdsqmdlhdihigyssgifslqerawaeqlylsmchevqkqldpqnrahrpiidelqermad kmyvnfslfqsmpdawgidqlfpvlplegldqvperravllditcdsdgaidhyidgdgiattmpmpey dpenppmlgffmvgayqeilgnmhnlfgdteavdvfvfpdgsvevelsdegdtvadmlqyvqldpktll tqfrdqvkktdldaelqqqfleefeaglygytylede
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.239
    Matthews' coefficent 3.70 Rfactor 0.200
    Waters 76 Solvent Content 66.77

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3nzq
    1. Structures of bacterial biosynthetic arginine decarboxylases
    F Forouhar, S Lew, J Seetharaman, R Xiao - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch