.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o6u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of CPE2226 protein from Clostridium perfringens. To be Published
    Site NESGC
    PDB Id 3o6u Target Id CpR195
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS55150,PF04205 Molecular Weight 16038.16 Da.
    Residues 147 Isoelectric Point 5.58
    Sequence mkkkffalilstlvasnfiacgasnnsklkdgdytvetakaddhgykaklsikvsdgkiteakynefng etnamkredkdynekmtgvsgigpaeyepqlekaliekqssdidvitgatsssnqfkklaekvlknaee gkteatlvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.50 Rfree 0.275
    Matthews' coefficent 2.31 Rfactor 0.204
    Waters 36 Solvent Content 46.67

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch