.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ohw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target SgR209E. To be Published
    Site NESGC
    PDB Id 3ohw Target Id SgR209E
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS55096,PF00427 Molecular Weight 17102.71 Da.
    Residues 148 Isoelectric Point 9.05
    Sequence nqgvtrqrqqtkvfklvstydkvavknairaayrqvferdlepyiinseftalesklsnneinvkefie glgtselymkefyapypntkviemgtkhflgraplnqkeiqqynqilasqglkafigamvngmeylqtf gedtvpyrrf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.266
    Matthews' coefficent 2.15 Rfactor 0.237
    Waters Solvent Content 42.66

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ohw
    1. Target highlights in CASP9: experimental target structures for the critical assessment of techniques for protein structure prediction
    A Kryshtafovych, J Moult, SG Bartual - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Crystal structure of the N_terminal domain of linker LR and the assembly of cyanobacterial phycobilisome rods
    X Gao, N Zhang, TD Wei, HN Su, BB Xie - Molecular , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch