.
The Open Protein Structure Annotation Network
PDB Keyword
.

3osj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESGC
    PDB Id 3osj Target Id SgR209C
    Related PDB Ids 2l06 
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS55094,PF00427, 17031 Molecular Weight 16773.19 Da.
    Residues 147 Isoelectric Point 9.53
    Sequence pqsyfnaaakrqkyamkpglsaleknavikaayrqiferditkaysqsisylesqvrngdismkefvrr laksplyrkqffepfinsralelafrhilgrgpssreevqkyfsivssgglpalvdalvdsqeyadyfg eetvpylrg
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3osj
    1. Target highlights in CASP9: experimental target structures for the critical assessment of techniques for protein structure prediction
    A Kryshtafovych, J Moult, SG Bartual - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Crystal structure of the N_terminal domain of linker LR and the assembly of cyanobacterial phycobilisome rods
    X Gao, N Zhang, TD Wei, HN Su, BB Xie - Molecular , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch