The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title LeuT-desipramine structure reveals how antidepressants block neurotransmitter reuptake. Science 317 1390-1393 2007
    Site NYCOMPS
    PDB Id 2qju Target Id GO.3204
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS31544,O67854 Molecular Weight 57404.95 Da.
    Residues 513 Isoelectric Point 8.77
    Sequence mevkrehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewamgryg gaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflvglvpepppnatdpd silrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirgiskgierfakiamptlfilav flvirvflletpngtaadglnflwtpdfeklkdpgvwiaavgqifftlslgfgaiityasyvrkdqdiv lsgltaatlnekaevilggsisipaavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwf fllffagltssiaimqpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvf fglteliiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtv witrfyiiglflfltflvflaerrrnhesa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.22
    Matthews' coefficent 2.71 Rfactor 0.199
    Waters 15 Solvent Content 54.63

    Ligand Information
    Ligands BOG (B-OCTYLGLUCOSIDE) x 4;LEU (3-(10,11-DIHYDRO-5H-DIBENZO[B,F]AZEPIN-5-YL)-N-) x 1;DSM x 1
    Metals NA (SODIUM) x 2;CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch