.
The Open Protein Structure Annotation Network
PDB Keyword
.

3llq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Aquaporin structure from plant pathogen Agrobacterium Tumerfaciens. To be Published
    Site NYCOMPS
    PDB Id 3llq Target Id GO.11661
    Molecular Characteristics
    Source Agrobacterium tumefaciens c58
    Alias Ids TPS48697, Molecular Weight 23136.80 Da.
    Residues 228 Isoelectric Point 7.93
    Sequence mgrkllaeffgtfwlvfggcgsavfaaafpelgigftgvalafgltvltmayavggisgghfnpavsvg ltvagrfpasslvpyviaqvagaivaaaalyviatgkagidlggfasngygehspggyslvsallieii ltafflivilgsthgrvpagfapiaiglaltlihlisipvtntsvnparstgqalfvggwalqqlwlfw lapivggaagaviwklfgekd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.21859
    Matthews' coefficent 3.21 Rfactor 0.18803
    Waters 62 Solvent Content 61.67

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch